1.67 Rating by ClearWebStats
pocketketo.com is 7 years 1 month 4 weeks old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, pocketketo.com is SAFE to browse.
Get Custom Widget

Traffic Report of Pocketketo

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
90
Siteadvisor Rating
View pocketketo.com site advisor rating Not Applicable

Where is pocketketo.com server located?

Hosted IP Address:

192.186.194.69 View other site hosted with pocketketo.com

Hosted Country:

pocketketo.com hosted country US pocketketo.com hosted country

Location Latitude:

33.6013

Location Longitude:

-111.8867

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View pocketketo.com HTML resources

Homepage Links Analysis

Pocket Keto – a pocket guide to ketogenic living

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 1
H3 Headings: 1 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 1
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 192.186.194.69)

Future Stars - Summer Sports and Specialty Camps in New York

pocketketo.com favicon - fscamps.com

Kids love Future Stars sports camps. Join us for a summer of sports and fun in Westchester or Long Island. Soccer, Tennis, Baseball, basketball and more.

View pocketketo.com Pagerank   pocketketo.com alexa rank 3,339,322   pocketketo.com website value $ 240.00

403 Forbidden

pocketketo.com favicon - mediacenterstreams.com

View pocketketo.com Pagerank   pocketketo.com alexa rank Not Applicable   pocketketo.com website value $ 8.95

My blog – Just another WordPress site

pocketketo.com favicon - utterfrugal.com

View pocketketo.com Pagerank   pocketketo.com alexa rank Not Applicable   pocketketo.com website value $ 8.95

NHS Scotland scorecard

pocketketo.com favicon - nhsscotland-scorecard.org

View pocketketo.com Pagerank   pocketketo.com alexa rank Not Applicable   pocketketo.com website value $ 8.95

WELCOME TO KADIRI LAKSHMI NARASIMHA SWAMY TEMPLE

pocketketo.com favicon - kadirilakshminarasimhaswamytemple.com

View pocketketo.com Pagerank   pocketketo.com alexa rank Not Applicable   pocketketo.com website value $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 30 Jun 2017 23:16:20 GMT
Server: Apache/2.4.25
X-Powered-By: PHP/5.4.45
Link: ; rel="https://api.w.org/"
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 16787
Content-Type: text/html; charset=UTF-8

Domain Information for pocketketo.com

Domain Registrar: GODADDY.COM, LLC pocketketo.com registrar info
Registration Date: 2017-02-15 7 years 1 month 4 weeks ago
Last Modified: 2017-03-15 7 years 1 month 1 day ago
Expiration Date: 2018-02-15 6 years 2 months 19 hours ago

Domain Nameserver Information

Host IP Address Country
ns71.domaincontrol.com pocketketo.com name server information 97.74.105.46 pocketketo.com server is located in United States United States
ns72.domaincontrol.com pocketketo.com name server information 173.201.73.46 pocketketo.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
pocketketo.com A 600 IP:192.186.194.69
pocketketo.com NS 3600 Target:ns71.domaincontrol.com
pocketketo.com NS 3600 Target:ns72.domaincontrol.com
pocketketo.com SOA 600 MNAME:ns71.domaincontrol.com
RNAME:dns.jomax.net
Serial:2017031500
Refresh:28800
Retry:7200
Expire:604800
pocketketo.com MX 3600 Target:mail.pocketketo.com
pocketketo.com TXT 3600 TXT:v=spf1 a mx ptr include:secureserver.net
~all

Similarly Ranked Websites to Pocketketo

Google

pocketketo.com favicon - google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

View pocketketo.com Pagerank   Alexa rank for pocketketo.com 1   website value of pocketketo.com $ 8,833,062,960.00

Google Calendar - Sign in to Access & Edit Your Schedule

pocketketo.com favicon - calendar.google.com

Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).

View pocketketo.com Pagerank   Alexa rank for pocketketo.com 1   website value of pocketketo.com $ 8,833,062,960.00

Gmail

pocketketo.com favicon - mail.google.com

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

View pocketketo.com Pagerank   Alexa rank for pocketketo.com 1   website value of pocketketo.com $ 8,833,062,960.00

Android Apps on Google Play

pocketketo.com favicon - play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

View pocketketo.com Pagerank   Alexa rank for pocketketo.com 1   website value of pocketketo.com $ 8,833,062,960.00

Google Chrome - Download the Fast, Secure Browser from Google

pocketketo.com favicon - chrome.google.com

Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.

View pocketketo.com Pagerank   Alexa rank for pocketketo.com 1   website value of pocketketo.com $ 8,833,062,960.00

Full WHOIS Lookup for pocketketo.com

Domain Name: pocketketo.com
Registrar URL: http://www.godaddy.com
Registrant Name: Adam Smith
Registrant Organization:
Name Server: NS71.DOMAINCONTROL.COM
Name Server: NS72.DOMAINCONTROL.COM
DNSSEC: unsigned

For complete domain details go to:
http://who.godaddy.com/whoischeck.aspx?domain=pocketketo.com

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.